PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10021762
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 271aa    MW: 29369.4 Da    PI: 7.9494
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10021762genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.82.9e-193984147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd  l+++v+++G+++W++I+r+++ gR++k+c++rw + 
      Lus10021762 39 KGPWSAEEDRVLIHLVNRHGPRNWSLISRYIN-GRSGKSCRLRWCNQ 84
                     79******************************.***********985 PP

2Myb_DNA-binding52.51.1e-1693135347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++ Ed  ++ a++++G++ W+tIar ++ gRt++ +k++w++ 
      Lus10021762  93 PFSPAEDHTILAAHARYGNR-WATIARLLP-GRTDNAIKNHWNST 135
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.6853489IPR017930Myb domain
SuperFamilySSF466892.08E-3136132IPR009057Homeodomain-like
SMARTSM007178.5E-153887IPR001005SANT/Myb domain
PfamPF002492.0E-183984IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-234092IPR009057Homeodomain-like
CDDcd001671.74E-154183No hitNo description
PROSITE profilePS5129420.74890140IPR017930Myb domain
SMARTSM007172.5E-1390138IPR001005SANT/Myb domain
PfamPF002493.7E-1493135IPR001005SANT/Myb domain
CDDcd001671.88E-1093136No hitNo description
Gene3DG3DSA:1.10.10.606.5E-2293139IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MDPMLHNNNN MCSTSSTTSD SSSSDSAATG SAKRTDRIKG PWSAEEDRVL IHLVNRHGPR  60
NWSLISRYIN GRSGKSCRLR WCNQLCPTVQ HRPFSPAEDH TILAAHARYG NRWATIARLL  120
PGRTDNAIKN HWNSTLKRRA FAGHGQTSSS SPPQAAVFHQ RAASDGNYST QEYCWNYGEG  180
SLSPAVPAAV VDVDEEEALT TLTLGPPGMG SGGGGQGMSN AAEERRAESM PAGFWDVMRG  240
VIAKEVREYV NSTMSSEESP TPTAAASYYH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-40381403105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002301201.12e-88hypothetical protein POPTR_0002s13030g
TrEMBLB9GNY72e-88B9GNY7_POPTR; Uncharacterized protein
STRINGPOPTR_0002s13030.15e-88(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50743256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.17e-56myb domain protein 70